SCOP 1.67: Domain d1ub6a2: 1ub6 A:117-214

Lineage for d1ub6a2 (1ub6 A:117-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1ub6a2: 1ub6 A:117-214 [99152]
   Other proteins in same PDB: d1ub6a1, d1ub6b1, d1ub6b2, d1ub6h1, d1ub6l1, d1ub6l2
   part of blue fluorescent Fab 19G2

Details for d1ub6a2

PDB Entry: 1ub6, 2.12 Å

PDB Description: Crystal structure of Antibody 19G2 with sera ligand

SCOP Domain Sequences for d1ub6a2:

Sequence; same for both SEQRES and ATOM records:

>d1ub6a2 b.1.1.2 (A:117-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvypaapgcgdttgssvtlgclvkgyfpesvtvtwnsggssvhtfpallqsgly
tmsssvtvpsstwpstvtcsvahpasgttvdkkle

Timeline for d1ub6a2:

• d1ub6a2 is new in SCOP 1.67
  
• d1ub6a2 appears in SCOP 1.69
  
• d1ub6a2 appears in the current release, SCOPe 2.08