SCOP 1.71: Domain d1uacy_: 1uac Y:

Lineage for d1uacy_ (1uac Y:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [53963] (13 PDB entries)

8. Domain d1uacy_: 1uac Y: [99134]
   Other proteins in same PDB: d1uach_, d1uacl_
   mutant

Details for d1uacy_

PDB Entry: 1uac, 1.7 Å

PDB Description: crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme

SCOP Domain Sequences for d1uacy_:

Sequence; same for both SEQRES and ATOM records:

>d1uacy_ d.2.1.2 (Y:) Lysozyme {Turkey (Meleagris gallopavo)}
kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
hawirgcrl

Timeline for d1uacy_:

• d1uacy_ first appeared in SCOP 1.67
  
• d1uacy_ appears in SCOP 1.69
  
• d1uacy_ appears in SCOP 1.73
  
• d1uacy_ appears in the current release, SCOPe 2.08