SCOPe 2.06: Domain d1uach1: 1uac H:1-113

Lineage for d1uach1 (1uac H:1-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)

8. Domain d1uach1: 1uac H:1-113 [99132]
   Other proteins in same PDB: d1uach2, d1uacl_, d1uacy_
   part of Fv HyHEL-10
   mutant

Details for d1uach1

PDB Entry: 1uac, 1.7 Å

PDB Description: crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme

PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d1uach1:

Sequence; same for both SEQRES and ATOM records:

>d1uach1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvssfgstfyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsa

Timeline for d1uach1:

• d1uach1 first appeared in SCOP 1.67, called d1uach_
  
• d1uach1 was called d1uach_ in SCOPe 2.05
  
• d1uach1 appears in SCOPe 2.07
  
• d1uach1 appears in the current release, SCOPe 2.08