Lineage for d1ua6h_ (1ua6 H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930322Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 930339Domain d1ua6h_: 1ua6 H: [99129]
    Other proteins in same PDB: d1ua6l_, d1ua6y_
    part of Fv HyHEL-10
    mutant

Details for d1ua6h_

PDB Entry: 1ua6 (more details), 1.9 Å

PDB Description: crystal structure of hyhel-10 fv mutant sfsf complexed with hen egg white lysozyme complex
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d1ua6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua6h_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvssfgstfyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d1ua6h_:

Click to download the PDB-style file with coordinates for d1ua6h_.
(The format of our PDB-style files is described here.)

Timeline for d1ua6h_: