Lineage for d1ua6h1 (1ua6 H:1-113)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)
  8. Domain d1ua6h1: 1ua6 H:1-113 [99129]
    Other proteins in same PDB: d1ua6h2, d1ua6l_, d1ua6y_
    part of Fv HyHEL-10
    mutant

Details for d1ua6h1

PDB Entry: 1ua6 (more details), 1.9 Å

PDB Description: crystal structure of hyhel-10 fv mutant sfsf complexed with hen egg white lysozyme complex
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d1ua6h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua6h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvssfgstfyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsa

SCOPe Domain Coordinates for d1ua6h1 are not available.

Timeline for d1ua6h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ua6h2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ua6l_, d1ua6y_