Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Lactate dehydrogenase [51859] (14 species) |
Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (2 PDB entries) |
Domain d1t2fc1: 1t2f C:1-160 [99092] Other proteins in same PDB: d1t2fa2, d1t2fb2, d1t2fc2, d1t2fd2 complexed with nad, oxq |
PDB Entry: 1t2f (more details), 3 Å
SCOPe Domain Sequences for d1t2fc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2fc1 c.2.1.5 (C:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig
Timeline for d1t2fc1: