Lineage for d1t2fa2 (1t2f A:161-332)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513617Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 513618Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 513619Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 513626Protein Lactate dehydrogenase [56339] (14 species)
  7. 513650Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [64444] (2 PDB entries)
  8. 513653Domain d1t2fa2: 1t2f A:161-332 [99089]
    Other proteins in same PDB: d1t2fa1, d1t2fb1, d1t2fc1, d1t2fd1

Details for d1t2fa2

PDB Entry: 1t2f (more details), 3 Å

PDB Description: human b lactate dehydrogenase complexed with nad+ and 4-hydroxy-1,2,5- oxadiazole-3-carboxylic acid

SCOP Domain Sequences for d1t2fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2fa2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain)}
sgcnldsarfrylmaeklgihpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvkgm
ygienevflslpcilnargltsvinqklkddevaqlkksadtlwdiqkdlkf

SCOP Domain Coordinates for d1t2fa2:

Click to download the PDB-style file with coordinates for d1t2fa2.
(The format of our PDB-style files is described here.)

Timeline for d1t2fa2: