Lineage for d1t2ea2 (1t2e A:164-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232720Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (14 PDB entries)
  8. 2232728Domain d1t2ea2: 1t2e A:164-329 [99087]
    Other proteins in same PDB: d1t2ea1, d1t2ea3
    complexed with gol, nai, oxm; mutant

Details for d1t2ea2

PDB Entry: 1t2e (more details), 1.85 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase S245A, A327P mutant complexed with NADH and oxamate
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1t2ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2ea2 d.162.1.1 (A:164-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaapyvapaaaiiemaesylkdlkkvlicstllegqygh
sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkpla

SCOPe Domain Coordinates for d1t2ea2:

Click to download the PDB-style file with coordinates for d1t2ea2.
(The format of our PDB-style files is described here.)

Timeline for d1t2ea2: