Lineage for d1t27a_ (1t27 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431422Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein)
    automatically mapped to Pfam PF02121
  6. 1431423Protein Phoshatidylinositol transfer protein, PITP [64389] (4 species)
  7. 1431431Species Norway rat (Rattus norvegicus) [TaxId:10116] [64390] (1 PDB entry)
  8. 1431432Domain d1t27a_: 1t27 A: [99075]
    complexed to phosphatidylcholine
    complexed with pcw

Details for d1t27a_

PDB Entry: 1t27 (more details), 2.2 Å

PDB Description: the structure of pitp complexed to phosphatidylcholine
PDB Compounds: (A:) Phosphatidylinositol transfer protein alpha isoform

SCOPe Domain Sequences for d1t27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t27a_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveaiyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

SCOPe Domain Coordinates for d1t27a_:

Click to download the PDB-style file with coordinates for d1t27a_.
(The format of our PDB-style files is described here.)

Timeline for d1t27a_: