![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein) |
![]() | Protein Phoshatidylinositol transfer protein, PITP [64389] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [64390] (1 PDB entry) |
![]() | Domain d1t27a_: 1t27 A: [99075] complexed to phosphatidylcholine complexed with pcw |
PDB Entry: 1t27 (more details), 2.2 Å
SCOPe Domain Sequences for d1t27a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t27a_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Norway rat (Rattus norvegicus) [TaxId: 10116]} vllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekddgekgqythk iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg tqenvhklepeawkhveaiyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqekrlftnfhrqlfcwldkwvdltm ddirrmeeetkrqldemrqkdpvkgmtad
Timeline for d1t27a_: