Lineage for d1t05a2 (1t05 A:1-429)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1951913Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1951914Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1951956Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (153 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1952227Domain d1t05a2: 1t05 A:1-429 [99061]
    Other proteins in same PDB: d1t05a1
    protein/DNA complex; complexed with gol, mg, tnv

Details for d1t05a2

PDB Entry: 1t05 (more details), 3 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1t05a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t05a2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d1t05a2:

Click to download the PDB-style file with coordinates for d1t05a2.
(The format of our PDB-style files is described here.)

Timeline for d1t05a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t05a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1t05b_