Lineage for d1t03l2 (1t03 L:108-211)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656477Domain d1t03l2: 1t03 L:108-211 [99059]
    Other proteins in same PDB: d1t03a1, d1t03a2, d1t03b_, d1t03h1, d1t03h2, d1t03l1
    part of Fab 28 against HIV-1 RT
    complexed with mg, mrg, tfo; mutant

Details for d1t03l2

PDB Entry: 1t03 (more details), 3.1 Å

PDB Description: HIV-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex P)
PDB Compounds: (L:) monoclonal antibody light chain

SCOP Domain Sequences for d1t03l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t03l2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1t03l2:

Click to download the PDB-style file with coordinates for d1t03l2.
(The format of our PDB-style files is described here.)

Timeline for d1t03l2: