Lineage for d1t03h1 (1t03 H:1-123)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782503Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
    SQ NA # part of Fab 28 against HIV-1 RT
  8. 782512Domain d1t03h1: 1t03 H:1-123 [99056]
    Other proteins in same PDB: d1t03a1, d1t03a2, d1t03b_, d1t03h2, d1t03l1, d1t03l2
    part of Fab 28 against HIV-1 RT
    complexed with mg, mrg, tfo; mutant

Details for d1t03h1

PDB Entry: 1t03 (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
PDB Compounds: (H:) monoclonal antibody heavy chain

SCOP Domain Sequences for d1t03h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t03h1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d1t03h1:

Click to download the PDB-style file with coordinates for d1t03h1.
(The format of our PDB-style files is described here.)

Timeline for d1t03h1: