SCOP 1.71: Domain d1t03h1: 1t03 H:1-123

Lineage for d1t03h1 (1t03 H:1-123)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)

8. Domain d1t03h1: 1t03 H:1-123 [99056]
   Other proteins in same PDB: d1t03a1, d1t03a2, d1t03b_, d1t03h2, d1t03l1, d1t03l2
   part of Fab 28 against HIV-1 RT
   complexed with mg, mrg, tfo; mutant

Details for d1t03h1

PDB Entry: 1t03, 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)

SCOP Domain Sequences for d1t03h1:

Sequence; same for both SEQRES and ATOM records:

>d1t03h1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

Timeline for d1t03h1:

• d1t03h1 first appeared in SCOP 1.67
  
• d1t03h1 appears in SCOP 1.69
  
• d1t03h1 appears in SCOP 1.73
  
• d1t03h1 appears in the current release, SCOPe 2.08