Lineage for d1t03a2 (1t03 A:1-429)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451898Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1451899Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1452158Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1452159Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1452191Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (138 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1452436Domain d1t03a2: 1t03 A:1-429 [99054]
    Other proteins in same PDB: d1t03a1, d1t03h1, d1t03h2, d1t03l1, d1t03l2
    protein/DNA complex; complexed with mg

Details for d1t03a2

PDB Entry: 1t03 (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1t03a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t03a2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d1t03a2:

Click to download the PDB-style file with coordinates for d1t03a2.
(The format of our PDB-style files is described here.)

Timeline for d1t03a2: