SCOPe 2.02: Domain d1t03a1: 1t03 A:430-558

Lineage for d1t03a1 (1t03 A:430-558)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1t03a1: 1t03 A:430-558 [99053]
   Other proteins in same PDB: d1t03a2, d1t03b_, d1t03h1, d1t03h2, d1t03l1, d1t03l2
   protein/DNA complex; complexed with mg

Details for d1t03a1

PDB Entry: 1t03, 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1t03a1:

Sequence; same for both SEQRES and ATOM records:

>d1t03a1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

Timeline for d1t03a1:

• d1t03a1 first appeared in SCOP 1.67
  
• d1t03a1 appears in SCOPe 2.01
  
• d1t03a1 appears in SCOPe 2.03
  
• d1t03a1 appears in the current release, SCOPe 2.08