Lineage for d1t03a1 (1t03 A:430-558)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 701967Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 701998Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 701999Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
  8. 702074Domain d1t03a1: 1t03 A:430-558 [99053]
    Other proteins in same PDB: d1t03a2, d1t03b_, d1t03h1, d1t03h2, d1t03l1, d1t03l2
    complexed with mg, mrg, tfo; mutant

Details for d1t03a1

PDB Entry: 1t03 (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
PDB Compounds: (A:) Pol polyprotein

SCOP Domain Sequences for d1t03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t03a1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOP Domain Coordinates for d1t03a1:

Click to download the PDB-style file with coordinates for d1t03a1.
(The format of our PDB-style files is described here.)

Timeline for d1t03a1: