![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (4 proteins) |
![]() | Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries) |
![]() | Domain d1t03a1: 1t03 A:430-558 [99053] Other proteins in same PDB: d1t03a2, d1t03b_, d1t03h1, d1t03h2, d1t03l1, d1t03l2 complexed with mg, mrg, tfo; mutant |
PDB Entry: 1t03 (more details), 3.1 Å
SCOP Domain Sequences for d1t03a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t03a1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsagirk
Timeline for d1t03a1: