Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [46619] (30 PDB entries) |
Domain d1szxb1: 1szx B:1-83 [99051] Other proteins in same PDB: d1szxa2, d1szxb2 complexed with mn |
PDB Entry: 1szx (more details), 1.95 Å
SCOPe Domain Sequences for d1szxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szxb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial qpalkfnggghinhsifwtnlsp
Timeline for d1szxb1: