Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Mammary gland protein (MGP-40) [89882] (1 species) secreted during involution |
Species Goat (Capra hircus) [TaxId:9925] [89883] (4 PDB entries) |
Domain d1syta2: 1syt A:240-307 [99041] Other proteins in same PDB: d1syta1 complexed with man, nag |
PDB Entry: 1syt (more details), 2.6 Å
SCOP Domain Sequences for d1syta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1syta2 d.26.3.1 (A:240-307) Mammary gland protein (MGP-40) {Goat (Capra hircus)} fgrsftlassktdggapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat kgnqwvay
Timeline for d1syta2: