SCOP 1.67: Domain d1syta2: 1syt A:240-307

Lineage for d1syta2 (1syt A:240-307)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Mammary gland protein (MGP-40) [89882] (1 species)
   secreted during involution

7. Species Goat (Capra hircus) [TaxId:9925] [89883] (4 PDB entries)

8. Domain d1syta2: 1syt A:240-307 [99041]
   Other proteins in same PDB: d1syta1
   complexed with man, nag

Details for d1syta2

PDB Entry: 1syt, 2.6 Å

PDB Description: crystal structure of signalling protein from goat spg-40 in the presense of n,n',n''-triacetyl-chitotriose at 2.6a resolution

SCOP Domain Sequences for d1syta2:

Sequence; same for both SEQRES and ATOM records:

>d1syta2 d.26.3.1 (A:240-307) Mammary gland protein (MGP-40) {Goat (Capra hircus)}
fgrsftlassktdggapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1syta2:

• d1syta2 is new in SCOP 1.67
  
• d1syta2 appears in SCOP 1.69
  
• d1syta2 appears in the current release, SCOPe 2.08