Lineage for d1syrd_ (1syr D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 486472Family c.47.1.1: Thioltransferase [52834] (11 proteins)
  6. 486522Protein Thioredoxin [52835] (10 species)
  7. 486595Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102431] (1 PDB entry)
  8. 486599Domain d1syrd_: 1syr D: [99031]

Details for d1syrd_

PDB Entry: 1syr (more details), 2.95 Å

PDB Description: initial structural analysis of plasmodium falciparum thioredoxin

SCOP Domain Sequences for d1syrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syrd_ c.47.1.1 (D:) Thioredoxin {Malarial parasite (Plasmodium falciparum)}
vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekya

SCOP Domain Coordinates for d1syrd_:

Click to download the PDB-style file with coordinates for d1syrd_.
(The format of our PDB-style files is described here.)

Timeline for d1syrd_: