SCOPe 2.05: Domain d1sv5b_: 1sv5 B:

Lineage for d1sv5b_ (1sv5 B:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (153 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1sv5b_: 1sv5 B: [99018]
   Other proteins in same PDB: d1sv5a1
   complexed with 65b; mutant

Details for d1sv5b_

PDB Entry: 1sv5, 2.9 Å

PDB Description: crystal structure of k103n mutant hiv-1 reverse transcriptase (rt) in complex with janssen-r165335

PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1sv5b_:

Sequence; same for both SEQRES and ATOM records:

>d1sv5b_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkknksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

Timeline for d1sv5b_:

• d1sv5b_ first appeared in SCOP 1.67
  
• d1sv5b_ appears in SCOPe 2.04
  
• d1sv5b_ appears in SCOPe 2.06
  
• d1sv5b_ appears in the current release, SCOPe 2.08