SCOPe 2.05: Domain d1suqa1: 1suq A:430-552

Lineage for d1suqa1 (1suq A:430-552)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (101 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1suqa1: 1suq A:430-552 [99003]
   Other proteins in same PDB: d1suqa2, d1suqb_
   complexed with 185, mg

Details for d1suqa1

PDB Entry: 1suq, 3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1suqa1:

Sequence; same for both SEQRES and ATOM records:

>d1suqa1 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d1suqa1:

• d1suqa1 first appeared in SCOP 1.67
  
• d1suqa1 appears in SCOPe 2.04
  
• d1suqa1 appears in SCOPe 2.06
  
• d1suqa1 appears in the current release, SCOPe 2.08