Lineage for d1so0b_ (1so0 B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460800Superfamily b.30.5: Galactose mutarotase-like [74650] (10 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 460989Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)
  6. 460994Protein Galactose mutarotase [74912] (2 species)
  7. 460995Species Human (Homo sapiens) [TaxId:9606] [101659] (2 PDB entries)
  8. 460999Domain d1so0b_: 1so0 B: [98933]

Details for d1so0b_

PDB Entry: 1so0 (more details), 2.3 Å

PDB Description: crystal structure of human galactose mutarotase complexed with galactose

SCOP Domain Sequences for d1so0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1so0b_ b.30.5.4 (B:) Galactose mutarotase {Human (Homo sapiens)}
masvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlgfa
elegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlwtp
rvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsyfn
lagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfhln
gfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavypk
hsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva

SCOP Domain Coordinates for d1so0b_:

Click to download the PDB-style file with coordinates for d1so0b_.
(The format of our PDB-style files is described here.)

Timeline for d1so0b_: