SCOP 1.75: Domain d1snfa_: 1snf A:

Lineage for d1snfa_ (1snf A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)

8. Domain d1snfa_: 1snf A: [98927]

Details for d1snfa_

PDB Entry: 1snf, 1.85 Å

PDB Description: mycobacterium tuberculosis dutpase complexed with magnesium and deoxyuridine 5'-monophosphate

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d1snfa_:

Sequence; same for both SEQRES and ATOM records:

>d1snfa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfde

Timeline for d1snfa_:

• d1snfa_ first appeared in SCOP 1.67
  
• d1snfa_ appears in SCOP 1.73
  
• d1snfa_ appears in SCOPe 2.01
  
• d1snfa_ appears in the current release, SCOPe 2.08