Lineage for d1sm4a2 (1sm4 A:208-362)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118600Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118601Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2118602Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2118621Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)
  7. 2118654Species Paprika (Capsicum annuum) [TaxId:4072] [52348] (2 PDB entries)
  8. 2118657Domain d1sm4a2: 1sm4 A:208-362 [98914]
    Other proteins in same PDB: d1sm4a1, d1sm4b1
    complexed with fad, po4

Details for d1sm4a2

PDB Entry: 1sm4 (more details), 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika
PDB Compounds: (A:) chloroplast ferredoxin-NADP+ oxidoreductase

SCOPe Domain Sequences for d1sm4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm4a2 c.25.1.1 (A:208-362) Ferredoxin reductase (flavodoxin reductase) {Paprika (Capsicum annuum) [TaxId: 4072]}
dpnatvimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqtnekgekmyiqtrmaqyaeelwtllkkdntfvymcglkgmeq
giddimsslaakegidwadykkqlkkaeqwnvevy

SCOPe Domain Coordinates for d1sm4a2:

Click to download the PDB-style file with coordinates for d1sm4a2.
(The format of our PDB-style files is described here.)

Timeline for d1sm4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sm4a1