SCOP 1.67: Domain d1skuc2: 1sku C:151-310

Lineage for d1skuc2 (1sku C:151-310)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)

7. Species Escherichia coli [TaxId:562] [53674] (30 PDB entries)

8. Domain d1skuc2: 1sku C:151-310 [98907]
   Other proteins in same PDB: d1skub1, d1skub2, d1skud1, d1skud2
   complexed with mli, zn; mutant

Details for d1skuc2

PDB Entry: 1sku, 2.6 Å

PDB Description: e. coli aspartate transcarbamylase 240's loop mutant (k244n)

SCOP Domain Sequences for d1skuc2:

Sequence; same for both SEQRES and ATOM records:

>d1skuc2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvnaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d1skuc2:

• d1skuc2 is new in SCOP 1.67
  
• d1skuc2 appears in SCOP 1.69
  
• d1skuc2 appears in the current release, SCOPe 2.08