SCOP 1.67: Domain d1shux_: 1shu X:

Lineage for d1shux_ (1shu X:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (4 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein Capillary morphogenesis protein 2 domain [102543] (1 species)
   Anthrax toxin receptor 2

7. Species Human (Homo sapiens) [TaxId:9606] [102544] (2 PDB entries)

8. Domain d1shux_: 1shu X: [98882]
   complexed with mg

Details for d1shux_

PDB Entry: 1shu, 1.5 Å

PDB Description: Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor

SCOP Domain Sequences for d1shux_:

Sequence; same for both SEQRES and ATOM records:

>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens)}
scrrafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltg
drgkiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvps
yaekeakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaqs
c

Timeline for d1shux_:

• d1shux_ is new in SCOP 1.67
  
• d1shux_ appears in SCOP 1.69
  
• d1shux_ appears in the current release, SCOPe 2.08