Lineage for d1sgxb4 (1sgx B:141-459)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851591Family d.3.1.4: Transglutaminase core [54044] (2 proteins)
  6. 851599Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 851617Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (8 PDB entries)
  8. 851621Domain d1sgxb4: 1sgx B:141-459 [98869]
    Other proteins in same PDB: d1sgxa1, d1sgxa2, d1sgxa3, d1sgxb1, d1sgxb2, d1sgxb3
    complexed with 5gp, ca, mg; mutant

Details for d1sgxb4

PDB Entry: 1sgx (more details), 2 Å

PDB Description: Crystal Structure of Transglutaminase 3 in Complex with Bound GMP: Structural Basis for Alteration in Nucleotide Specificity
PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOP Domain Sequences for d1sgxb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgxb4 d.3.1.4 (B:141-459) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr
daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswngsveilknwk
ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld
kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq
lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk
ypegsdqerqvfqkalgkl

SCOP Domain Coordinates for d1sgxb4:

Click to download the PDB-style file with coordinates for d1sgxb4.
(The format of our PDB-style files is described here.)

Timeline for d1sgxb4: