SCOP 1.69: Domain d1sgxb3: 1sgx B:594-692

Lineage for d1sgxb3 (1sgx B:594-692)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (8 PDB entries)

8. Domain d1sgxb3: 1sgx B:594-692 [98868]
   Other proteins in same PDB: d1sgxa1, d1sgxa4, d1sgxb1, d1sgxb4

Details for d1sgxb3

PDB Entry: 1sgx, 2 Å

PDB Description: Crystal Structure of Transglutaminase 3 in Complex with Bound GMP: Structural Basis for Alteration in Nucleotide Specificity

SCOP Domain Sequences for d1sgxb3:

Sequence; same for both SEQRES and ATOM records:

>d1sgxb3 b.1.5.1 (B:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3}
ptltlevlnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpker
srvrfdilpsrsgtkqlladfscnkfpaikamlsidvae

Timeline for d1sgxb3:

• d1sgxb3 first appeared in SCOP 1.67
  
• d1sgxb3 appears in SCOP 1.71
  
• d1sgxb3 last appears in SCOP 1.75