Lineage for d1sgxb1 (1sgx B:1-140)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552370Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 552371Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 552389Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (8 PDB entries)
  8. 552393Domain d1sgxb1: 1sgx B:1-140 [98866]
    Other proteins in same PDB: d1sgxa2, d1sgxa3, d1sgxa4, d1sgxb2, d1sgxb3, d1sgxb4
    complexed with 5gp, ca, mg; mutant

Details for d1sgxb1

PDB Entry: 1sgx (more details), 2 Å

PDB Description: Crystal Structure of Transglutaminase 3 in Complex with Bound GMP: Structural Basis for Alteration in Nucleotide Specificity

SCOP Domain Sequences for d1sgxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgxb1 b.1.18.9 (B:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOP Domain Coordinates for d1sgxb1:

Click to download the PDB-style file with coordinates for d1sgxb1.
(The format of our PDB-style files is described here.)

Timeline for d1sgxb1: