SCOP 1.75: Domain d1sgxa2: 1sgx A:479-593

Lineage for d1sgxa2 (1sgx A:479-593)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (8 PDB entries)

8. Domain d1sgxa2: 1sgx A:479-593 [98863]
   Other proteins in same PDB: d1sgxa1, d1sgxa4, d1sgxb1, d1sgxb4

Details for d1sgxa2

PDB Entry: 1sgx, 2 Å

PDB Description: Crystal Structure of Transglutaminase 3 in Complex with Bound GMP: Structural Basis for Alteration in Nucleotide Specificity

PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOP Domain Sequences for d1sgxa2:

Sequence; same for both SEQRES and ATOM records:

>d1sgxa2 b.1.5.1 (A:479-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
epsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsa
tmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn

Timeline for d1sgxa2:

• d1sgxa2 first appeared in SCOP 1.67
  
• d1sgxa2 appears in SCOP 1.73
  
• d1sgxa2 does not appear in SCOPe 2.01