Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (8 PDB entries) |
Domain d1sgxa1: 1sgx A:1-140 [98862] Other proteins in same PDB: d1sgxa2, d1sgxa3, d1sgxa4, d1sgxb2, d1sgxb3, d1sgxb4 |
PDB Entry: 1sgx (more details), 2 Å
SCOP Domain Sequences for d1sgxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgxa1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3} aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg gissvklgtfillfnpwlnv
Timeline for d1sgxa1:
View in 3D Domains from other chains: (mouse over for more information) d1sgxb1, d1sgxb2, d1sgxb3, d1sgxb4 |