Lineage for d1sgxa1 (1sgx A:1-140)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456110Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 456484Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 456485Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 456503Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (8 PDB entries)
  8. 456506Domain d1sgxa1: 1sgx A:1-140 [98862]
    Other proteins in same PDB: d1sgxa2, d1sgxa3, d1sgxa4, d1sgxb2, d1sgxb3, d1sgxb4

Details for d1sgxa1

PDB Entry: 1sgx (more details), 2 Å

PDB Description: Crystal Structure of Transglutaminase 3 in Complex with Bound GMP: Structural Basis for Alteration in Nucleotide Specificity

SCOP Domain Sequences for d1sgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgxa1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOP Domain Coordinates for d1sgxa1:

Click to download the PDB-style file with coordinates for d1sgxa1.
(The format of our PDB-style files is described here.)

Timeline for d1sgxa1: