SCOPe 2.07: Domain d1sg3b2: 1sg3 B:195-343

Lineage for d1sg3b2 (1sg3 B:195-343)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.22: Allantoicase repeat [101588] (1 protein)
   automatically mapped to Pfam PF03561

6. Protein Allantoicase [101589] (1 species)
   duplication: tandem repeat of two similar domains

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101590] (2 PDB entries)
   Yir029w

8. Domain d1sg3b2: 1sg3 B:195-343 [98850]
   Other proteins in same PDB: d1sg3b3

Details for d1sg3b2

PDB Entry: 1sg3, 2.6 Å

PDB Description: structure of allantoicase

PDB Compounds: (B:) Allantoicase

SCOPe Domain Sequences for d1sg3b2:

Sequence, based on SEQRES records:

>d1sg3b2 b.18.1.22 (B:195-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgr
essfiekiivdtahfrgnfpqfitvegclkesessentgegtwvelvgksktgpdkehvy
eirksirvshvkltiipdggvkrirvwgy

Sequence, based on observed residues (ATOM records):

>d1sg3b2 b.18.1.22 (B:195-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgr
essfiekiivdtahfrgnfpqfitvegclktwvelvgksktgpdkehvyeirksirvshv
kltiipdggvkrirvwgy

Timeline for d1sg3b2:

• d1sg3b2 first appeared in SCOP 1.67
  
• d1sg3b2 appears in SCOPe 2.06
  
• d1sg3b2 appears in the current release, SCOPe 2.08