![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins) Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor permutation of the common fold; strand 8 is antiparallel to the rest of the barrel |
![]() | Protein Unnamed hypothetical protein [102082] (1 species) homologue of BH2215 from the complete Bacillus halodurans genome |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [102083] (1 PDB entry) |
![]() | Domain d1sfsa_: 1sfs A: [98846] structural genomics complexed with po4 |
PDB Entry: 1sfs (more details), 1.07 Å
SCOPe Domain Sequences for d1sfsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfsa_ c.1.8.8 (A:) Unnamed hypothetical protein {Bacillus stearothermophilus [TaxId: 1422]} giwgvdsaqvvtdqlfqcvrtelgypkfwgrylsevpnvsegltrdeivrirnygvkvlp iynafreavgyangqvaarnavfharrlgipknkllfaniedffavdaawiaawvetlyp tgyrpglyadptkgdfaaayceavsrnnqvavqaviwsaaprpgttkeqkapryqpaapp csanvwvwqygrdaevcpvdtnladrrlldfly
Timeline for d1sfsa_: