Lineage for d1sfsa_ (1sfs A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095097Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins)
    Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
    permutation of the common fold; strand 8 is antiparallel to the rest of the barrel
  6. 2095105Protein Unnamed hypothetical protein [102082] (1 species)
    homologue of BH2215 from the complete Bacillus halodurans genome
  7. 2095106Species Bacillus stearothermophilus [TaxId:1422] [102083] (1 PDB entry)
  8. 2095107Domain d1sfsa_: 1sfs A: [98846]
    structural genomics
    complexed with po4

Details for d1sfsa_

PDB Entry: 1sfs (more details), 1.07 Å

PDB Description: 1.07 a crystal structure of an uncharacterized b. stearothermophilus protein
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1sfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfsa_ c.1.8.8 (A:) Unnamed hypothetical protein {Bacillus stearothermophilus [TaxId: 1422]}
giwgvdsaqvvtdqlfqcvrtelgypkfwgrylsevpnvsegltrdeivrirnygvkvlp
iynafreavgyangqvaarnavfharrlgipknkllfaniedffavdaawiaawvetlyp
tgyrpglyadptkgdfaaayceavsrnnqvavqaviwsaaprpgttkeqkapryqpaapp
csanvwvwqygrdaevcpvdtnladrrlldfly

SCOPe Domain Coordinates for d1sfsa_:

Click to download the PDB-style file with coordinates for d1sfsa_.
(The format of our PDB-style files is described here.)

Timeline for d1sfsa_: