Lineage for d1sc5a2 (1sc5 A:168-233)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534151Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 534170Family a.4.13.2: Sigma4 domain [88665] (4 proteins)
  6. 534171Protein Sigma factor sigma-28 (FliA) [101057] (1 species)
  7. 534172Species Aquifex aeolicus [TaxId:63363] [101058] (2 PDB entries)
  8. 534177Domain d1sc5a2: 1sc5 A:168-233 [98799]
    Other proteins in same PDB: d1sc5a1, d1sc5a3, d1sc5b_

Details for d1sc5a2

PDB Entry: 1sc5 (more details), 3.26 Å

PDB Description: Sigma-28(FliA)/FlgM complex

SCOP Domain Sequences for d1sc5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc5a2 a.4.13.2 (A:168-233) Sigma factor sigma-28 (FliA) {Aquifex aeolicus}
evikreltekvkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkakaler
lremls

SCOP Domain Coordinates for d1sc5a2:

Click to download the PDB-style file with coordinates for d1sc5a2.
(The format of our PDB-style files is described here.)

Timeline for d1sc5a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sc5b_