SCOPe 2.08: Domain d1sbkb1: 1sbk B:1-136

Lineage for d1sbkb1 (1sbk B:1-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)

8. Domain d1sbkb1: 1sbk B:1-136 [98792]
   Other proteins in same PDB: d1sbka2, d1sbkb2, d1sbkc2, d1sbkd2
   structural genomics; NESG target ER29
   complexed with so4

Details for d1sbkb1

PDB Entry: 1sbk, 2 Å

PDB Description: x-ray structure of ydii_ecoli northeast structural genomics consortium target er29.

PDB Compounds: (B:) Hypothetical protein ydiI

SCOPe Domain Sequences for d1sbkb1:

Sequence; same for both SEQRES and ATOM records:

>d1sbkb1 d.38.1.5 (B:1-136) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttail

Timeline for d1sbkb1:

• d1sbkb1 first appeared in SCOP 1.67, called d1sbkb_
  
• d1sbkb1 appears in SCOPe 2.07