SCOPe 2.04: Domain d1s9vb2: 1s9v B:3-94

Lineage for d1s9vb2 (1s9v B:3-94)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102835] (1 PDB entry)

8. Domain d1s9vb2: 1s9v B:3-94 [98763]
   Other proteins in same PDB: d1s9va1, d1s9va2, d1s9vb1, d1s9vd1, d1s9vd2, d1s9ve1
   complexed with deamidated gliadin peptide
   complexed with edo

Details for d1s9vb2

PDB Entry: 1s9v, 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide

PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ(1) beta chain

SCOPe Domain Sequences for d1s9vb2:

Sequence; same for both SEQRES and ATOM records:

>d1s9vb2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2 [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlqrr

Timeline for d1s9vb2:

• d1s9vb2 first appeared in SCOP 1.67
  
• d1s9vb2 appears in SCOPe 2.03
  
• d1s9vb2 appears in SCOPe 2.05
  
• d1s9vb2 appears in the current release, SCOPe 2.08