Lineage for d1s9va2 (1s9v A:2-84)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642339Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1642342Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102833] (1 PDB entry)
  8. 1642343Domain d1s9va2: 1s9v A:2-84 [98761]
    Other proteins in same PDB: d1s9va1, d1s9vb1, d1s9vb2, d1s9vd1, d1s9ve1, d1s9ve2
    complexed with deamidated gliadin peptide
    complexed with edo

Details for d1s9va2

PDB Entry: 1s9v (more details), 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ(3) alpha chain

SCOPe Domain Sequences for d1s9va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9va2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2 [TaxId: 9606]}
vadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfalt
niavlkhnlnslikrsnstaatn

SCOPe Domain Coordinates for d1s9va2:

Click to download the PDB-style file with coordinates for d1s9va2.
(The format of our PDB-style files is described here.)

Timeline for d1s9va2: