SCOP 1.75: Domain d1s9gb_: 1s9g B:

Lineage for d1s9gb_ (1s9g B:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (111 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582
   Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584
   Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1s9gb_: 1s9g B: [98757]
   Other proteins in same PDB: d1s9ga1
   complexed with abz; mutant

Details for d1s9gb_

PDB Entry: 1s9g, 2.8 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r120394.

PDB Compounds: (B:) POL polyprotein [Contains: Reverse transcriptase]

SCOP Domain Sequences for d1s9gb_:

Sequence; same for both SEQRES and ATOM records:

>d1s9gb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
ikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyq
ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
pivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaele
laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
vklwy

Timeline for d1s9gb_:

• d1s9gb_ first appeared in SCOP 1.67
  
• d1s9gb_ appears in SCOP 1.73
  
• d1s9gb_ appears in SCOPe 2.01
  
• d1s9gb_ appears in the current release, SCOPe 2.08