Lineage for d1s9eb_ (1s9e B:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1234135Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1234136Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1234302Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1234303Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1234322Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (114 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1234443Domain d1s9eb_: 1s9e B: [98754]
    Other proteins in same PDB: d1s9ea1
    complexed with adb

Details for d1s9eb_

PDB Entry: 1s9e (more details), 2.6 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385
PDB Compounds: (B:) POL polyprotein [Contains: Reverse transcriptase]

SCOPe Domain Sequences for d1s9eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9eb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

SCOPe Domain Coordinates for d1s9eb_:

Click to download the PDB-style file with coordinates for d1s9eb_.
(The format of our PDB-style files is described here.)

Timeline for d1s9eb_: