SCOP 1.71: Domain d1s9eb_: 1s9e B:

Lineage for d1s9eb_ (1s9e B:)

1. Root: SCOP 1.71

2. Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (83 PDB entries)

8. Domain d1s9eb_: 1s9e B: [98754]
   Other proteins in same PDB: d1s9ea1
   complexed with adb; mutant

Details for d1s9eb_

PDB Entry: 1s9e, 2.6 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385

SCOP Domain Sequences for d1s9eb_:

Sequence; same for both SEQRES and ATOM records:

>d1s9eb_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwy

Timeline for d1s9eb_:

• d1s9eb_ first appeared in SCOP 1.67
  
• d1s9eb_ appears in SCOP 1.69
  
• d1s9eb_ appears in SCOP 1.73
  
• d1s9eb_ appears in the current release, SCOPe 2.08