SCOP 1.71: Domain d1s9da_: 1s9d A:

Lineage for d1s9da_ (1s9d A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (8 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (8 PDB entries)

8. Domain d1s9da_: 1s9d A: [98750]
   Other proteins in same PDB: d1s9de_
   complexed with a sec7 domain
   complexed with afb, gdp, mg; mutant

Details for d1s9da_

PDB Entry: 1s9d, 1.8 Å

PDB Description: arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain

SCOP Domain Sequences for d1s9da_:

Sequence, based on SEQRES records:

>d1s9da_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlr

Sequence, based on observed residues (ATOM records):

>d1s9da_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1}
mrilmvgldaagkttilyklktiptigfnvetveyknisftvwdvggqdkirplwrhyfq
ntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaaeitdkl
glhslrhrnwyiqatcatsgdglyegldwlsnqlr

Timeline for d1s9da_:

• d1s9da_ first appeared in SCOP 1.67
  
• d1s9da_ appears in SCOP 1.69
  
• d1s9da_ appears in SCOP 1.73
  
• d1s9da_ appears in the current release, SCOPe 2.08