Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
Protein Trypsin(ogen) [50515] (8 species) |
Species Cow (Bos taurus) [TaxId:9913] [50516] (213 PDB entries) |
Domain d1s82a_: 1s82 A: [98717] complexed with ca, egl, na, sbe, so4 |
PDB Entry: 1s82 (more details), 1.85 Å
SCOP Domain Sequences for d1s82a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s82a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)} ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
Timeline for d1s82a_: