Lineage for d1s7xk_ (1s7x K:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1513477Protein beta2-microglobulin [88600] (5 species)
  7. 1514079Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
    Uniprot P01887
  8. 1514194Domain d1s7xk_: 1s7x K: [98714]
    Other proteins in same PDB: d1s7xa1, d1s7xa2, d1s7xd1, d1s7xd2, d1s7xg1, d1s7xg2, d1s7xj1, d1s7xj2

Details for d1s7xk_

PDB Entry: 1s7x (more details), 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (K:) Beta-2-microglobulin

SCOPe Domain Sequences for d1s7xk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7xk_ b.1.1.2 (K:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1s7xk_:

Click to download the PDB-style file with coordinates for d1s7xk_.
(The format of our PDB-style files is described here.)

Timeline for d1s7xk_: