Lineage for d1s7xk_ (1s7x K:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784280Domain d1s7xk_: 1s7x K: [98714]
    Other proteins in same PDB: d1s7xa1, d1s7xa2, d1s7xd1, d1s7xd2, d1s7xg1, d1s7xg2, d1s7xj1, d1s7xj2
    mutant

Details for d1s7xk_

PDB Entry: 1s7x (more details), 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (K:) Beta-2-microglobulin

SCOP Domain Sequences for d1s7xk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7xk_ b.1.1.2 (K:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1s7xk_:

Click to download the PDB-style file with coordinates for d1s7xk_.
(The format of our PDB-style files is described here.)

Timeline for d1s7xk_: