SCOPe 2.06: Domain d1s7xg1: 1s7x G:182-276

Lineage for d1s7xg1 (1s7x G:182-276)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d1s7xg1: 1s7x G:182-276 [98709]
   Other proteins in same PDB: d1s7xa2, d1s7xb_, d1s7xd2, d1s7xe_, d1s7xg2, d1s7xh_, d1s7xj2, d1s7xk_

Details for d1s7xg1

PDB Entry: 1s7x, 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1s7xg1:

Sequence; same for both SEQRES and ATOM records:

>d1s7xg1 b.1.1.2 (G:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d1s7xg1:

• d1s7xg1 first appeared in SCOP 1.67
  
• d1s7xg1 appears in SCOPe 2.05
  
• d1s7xg1 appears in SCOPe 2.07
  
• d1s7xg1 appears in the current release, SCOPe 2.08