Lineage for d1s7xg1 (1s7x G:182-276)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364706Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)
  8. 364751Domain d1s7xg1: 1s7x G:182-276 [98709]
    Other proteins in same PDB: d1s7xa2, d1s7xb_, d1s7xd2, d1s7xe_, d1s7xg2, d1s7xh_, d1s7xj2, d1s7xk_

Details for d1s7xg1

PDB Entry: 1s7x (more details), 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
PDB Compounds: (G:)

SCOP Domain Sequences for d1s7xg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7xg1 b.1.1.2 (G:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

SCOP Domain Coordinates for d1s7xg1:

Click to download the PDB-style file with coordinates for d1s7xg1.
(The format of our PDB-style files is described here.)

Timeline for d1s7xg1: