| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
| Domain d1s7xd1: 1s7x D:182-276 [98706] Other proteins in same PDB: d1s7xa2, d1s7xb_, d1s7xd2, d1s7xe_, d1s7xg2, d1s7xh_, d1s7xj2, d1s7xk_ |
PDB Entry: 1s7x (more details), 2.41 Å
SCOPe Domain Sequences for d1s7xd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7xd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep
Timeline for d1s7xd1: