SCOPe 2.06: Domain d1s7xa2: 1s7x A:1-181

Lineage for d1s7xa2 (1s7x A:1-181)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (27 PDB entries)
Domain d1s7xa2: 1s7x A:1-181 [98704]
Other proteins in same PDB: d1s7xa1, d1s7xb_, d1s7xd1, d1s7xe_, d1s7xg1, d1s7xh_, d1s7xj1, d1s7xk_

Details for d1s7xa2

PDB Entry: 1s7x (more details), 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1s7xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7xa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1s7xa2:

Click to download the PDB-style file with coordinates for d1s7xa2.
(The format of our PDB-style files is described here.)

Timeline for d1s7xa2: