SCOP 1.69: Domain d1s7xa1: 1s7x A:182-276

Lineage for d1s7xa1 (1s7x A:182-276)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)

8. Domain d1s7xa1: 1s7x A:182-276 [98703]
   Other proteins in same PDB: d1s7xa2, d1s7xb_, d1s7xd2, d1s7xe_, d1s7xg2, d1s7xh_, d1s7xj2, d1s7xk_

Details for d1s7xa1

PDB Entry: 1s7x, 2.41 Å

PDB Description: crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants

SCOP Domain Sequences for d1s7xa1:

Sequence; same for both SEQRES and ATOM records:

>d1s7xa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d1s7xa1:

• d1s7xa1 first appeared in SCOP 1.67
  
• d1s7xa1 appears in SCOP 1.71
  
• d1s7xa1 appears in the current release, SCOPe 2.08